콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

HPA014785

Sigma-Aldrich

Anti-TRPM1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-CSNB1C, Anti-LTRPC1, Anti-MLSN1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:50- 1:200

면역원 서열

VGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSLHGHPRNVKSIQGKL

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... TRPM1(4308)

일반 설명

TRPM1 (transient receptor potential cation channel, subfamily M, member 1) belongs to the subfamily of ion channels called TRPM. It was the first member of this family to be identified, and it was recognized as a melanoma metastasis suppressor. It is expressed by melanocytes of skin and eye. This ion channel is also coupled with mGluR6 (metabotropic glutamate receptor 6), and co-localizes with it at the dendrites of ON-bipolar cells. This gene is localized to human chromosome 15q13.3.

면역원

Transient receptor potential cation channel subfamily M member 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-TRPM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

생화학적/생리학적 작용

TRPM1 (transient receptor potential cation channel, subfamily M, member 1) is responsible for the control of Ca2+ homeostasis during melanogenesis, which is also influenced by ultraviolet B. Its expression and the intracellular Ca2+ levels are significantly lower in rapidly dividing melanocytes, as opposed to differentiated melanocytes. It is also under-expressed in melanomas with metastatic potential. TRPM1 mRNA expression can be helpful in differentiating Spitz nevi and nodular melanomas. It is essential for synaptic communication between photoreceptors and ON-bipolar cells. In patients with Melanoma-associated retinopathy (MAR), the auto-antibodies are shown to bind with TRPM1 in bipolar cells, and might be responsible for non-responsiveness of cells to light. This gene is also linked with autosomal recessive congenital stationary night blindness.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73285.

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Anuradha Dhingra et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 31(11), 3962-3967 (2011-03-18)
Melanoma-associated retinopathy (MAR) is characterized by night blindness, photopsias, and a selective reduction of the electroretinogram b-wave. In certain cases, the serum contains autoantibodies that react with ON bipolar cells, but the target of these autoantibodies has not been identified.
Alice Masurel-Paulet et al.
American journal of medical genetics. Part A, 164A(6), 1537-1544 (2014-03-29)
The 15q13.3 heterozygous microdeletion is a fairly common microdeletion syndrome with marked clinical variability and incomplete penetrance. The average size of the deletion, which comprises six genes including CHRNA7, is 1.5 Mb. CHRNA7 has been identified as the gene responsible
Jacqueline Gayet-Primo et al.
Frontiers in cellular neuroscience, 9, 486-486 (2016-01-07)
Photoreceptor degeneration differentially impacts glutamatergic signaling in downstream On and Off bipolar cells. In rodent models, photoreceptor degeneration leads to loss of glutamatergic signaling in On bipolar cells, whereas Off bipolar cells appear to retain glutamate sensitivity, even after extensive
Juliette Varin et al.
PloS one, 15(4), e0231750-e0231750 (2020-04-24)
Melanoma-associated retinopathy (MAR) is a rare paraneoplastic retinal disorder usually occurring in the context of metastatic melanoma. Patients present with night blindness, photopsias and a constriction of the visual field. MAR is an auto-immune disorder characterized by the production of
Lori A Erickson et al.
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, 22(7), 969-976 (2009-04-28)
The transient receptor potential cation channel, subfamily M, member 1 (TRPM1/Melastatin-1/MLSN-1) expression has been shown to have prognostic utility in the evaluation of primary cutaneous melanoma. We analyzed a series of spindled and epithelioid cell nevi (Spitz) and primary cutaneous

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.