콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA014765

Sigma-Aldrich

Anti-ITPR1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-ACV, Anti-IP3R1, Anti-Insp3r1, Anti-PPP1R94, Anti-SCA15, Anti-SCA16, Anti-SCA29

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

면역원 서열

KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ITPR1(3708)

일반 설명

ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1) is a ligand-gated calcium channel, which is present in the endoplasmic reticulum (ER). It either acts as a homotetarmer or forms heterotetramer with type 2 or type 3 inositol 1,4,5-trisphosphate receptors. It is highly expressed in the central nervous system, especially in the Purkinje cells of the cerebellum. This channel contains a coupling/regulatory domain, which consists of phosphorylation sites, a proteolytic cleavage region, ATP-binding sites, and binding sites for multiple proteins. This gene is localized to human chromosome 3p26.

면역원

Inositol 1,4,5-trisphosphate receptor type 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1) is a Ca2+-channel, which is activated upon binding by inositol 1,4,5-trisphosphate (IP3), and releases Ca2+ from endoplasmic reticulum (ER) into the cytoplasm. This released calcium participates in various Ca2+-dependent signaling and cellular processes. It is activated on death receptor binding or cellular damage, and regulates intracellular calcium levels during apoptosis. Heterozygous deletion in this gene is responsible for the autosomal dominant neurodegenerative disorder spinocerebellar ataxia type 15 (SCA15), which is characterized by late-onset, slow-progressive cerebellar ataxia. It is involved in the activation of T-cells, where it gets phosphorylated at Y353 residue, located at the IP3-binding domain. It plays an essential role in the initial stages of myoblast differentiation, where it induces the expression of myogenin and MEF2 (myocyte enhancer factor 2), which are transcription factors specific to muscles. ITPR1 is also essential for development and maintenance of cerebellum.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73267

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Masato Obayashi et al.
Journal of human genetics, 57(3), 202-206 (2012-02-10)
Spinocerebellar ataxia type 15 (SCA15) is an autosomal dominant neurodegenerative disorder clinically characterized by late-onset, slowly progressive pure cerebellar ataxia. This disease is caused by a heterozygous deletion of the inositol 1, 4, 5-triphosphate receptor type 1 (ITPR1) gene, suggesting
Fabrice Antigny et al.
Cell calcium, 56(6), 513-521 (2014-12-04)
Cytosolic Ca(2+) signals are fundamental for the early and late steps of myoblast differentiation and are, as in many cells, generated by Ca(2+) release from internal stores as well as by plasma membrane Ca(2+) entry. Our recent studies identified the
Margaret P Adam et al.
GeneReviews(?), 2006 May 30 (Updated 2014 Jun 12) (2014-06-12)
Spinocerebellar ataxia type 15 (SCA15) is characterized by slowly progressive gait and limb ataxia, often in combination with ataxic dysarthria, titubation, upper limb postural tremor, mild hyperreflexia, gaze-evoked nystagmus, and impaired vestibuloocular reflex gain. Onset is between ages seven and
Lijia Huang et al.
Orphanet journal of rare diseases, 7, 67-67 (2012-09-19)
Congenital nonprogressive spinocerebellar ataxia is characterized by early gross motor delay, hypotonia, gait ataxia, mild dysarthria and dysmetria. The clinical presentation remains fairly stable and may be associated with cerebellar atrophy. To date, only a few families with autosomal dominant
Nikhil deSouza et al.
The Journal of cell biology, 179(5), 923-934 (2007-12-07)
Sustained elevation of intracellular calcium by Ca2+ release-activated Ca2+ channels is required for lymphocyte activation. Sustained Ca2+ entry requires endoplasmic reticulum (ER) Ca2+ depletion and prolonged activation of inositol 1,4,5-trisphosphate receptor (IP(3)R)/Ca2+ release channels. However, a major isoform in lymphocyte

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.