HPA011351

Anti-SPINK5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-LEKTI antibody produced in rabbit, Anti-Lympho-epithelial Kazal-type-related inhibitor antibody produced in rabbit, Anti-Serine protease inhibitor Kazal-type 5 precursor antibody produced in rabbit
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA011351
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: QQEERARAKAKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLEEEEKKNDKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPC
• UniProt 수납 번호: Q9NQ38
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SPINK5(11005)

설명

일반 설명

SPINK5 (serine protease inhibitor Kazal-type 5) is a secreted multi-domain serine protease inhibitor. It is expressed in hair follicles in the inner root sheets and in the epidermis in the granular layer. This protein contains 15 serine protease inhibitor domains. It is composed of 1064 amino acids, and has a signal peptide. It is synthesized as a pro-protein, which is cleaved into different isoforms. Three isoforms of this protein exist- a short isoform with only the first 13 domains, the 15 domain isoform, and a long isoform with a 30 amino acid stretch inserted between domains 13 and 14. The molecular weight of 15 domain isoform is ~120kDa. SPINK5 gene is localized to human chromosome 5q32, and is made of 33 exons.

면역원

Serine protease inhibitor Kazal-type 5 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

SPINK5 (serine protease inhibitor Kazal-type 5) inactivates kallikrein (KLK)5, KLK7, and KLK14, which are epidermal proteases. KLKs are proteases related to desquamation, and SPINK5 is involved in the negative regulation of KLKs, as well as other proteases. Therefore, for normal skin barrier function and desquamation, a balance between KLKs and SPINK5 is essential. Mutations in this gene are associated with Comèl-Netherton syndrome, which is an autosomal recessive disorder. It is characterized by abnormalities in the hair shaft, congenital ichthyosis, and atopic diathesis. Loss of SPINK5 activity leads to increased corneodesmosomal component desmoglein-1 (DSG1) degradation, resulting in aberrant stratum corneum detachment. SPINK5 420K variant is responsible for changes in the proteolytic activation of SPINK5, which increases the likelihood of atopic dermatitis.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70808

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)