생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry: 1:50- 1:200
면역원 서열
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MRAP(56246)
일반 설명
MRAP (melanocortin 2 receptor accessory protein) is a small transmembrane protein which spans the cell membrane once. It is a paralogue of MRAP2. This protein resides in endoplasmic reticulum (ER) and plasma membrane. In adrenal cortex, it is expressed in glucocorticoid producing cells, in zona fasciculate and in the undifferentiated zone. It is also expressed in brain and pituitary. MRAP is composed of 172 amino acids and has a highly conserved N-terminus. Due to alternative splicing, MRAP has two isoforms which differ in their C-termini. These isoforms called MRAPα (19kDa) and MRAPβ (14kDa), exhibit same level of expression in adrenal gland. MRAPα is found predominantly in ER whereas MRAPβ is localized more in the plasma membrane. It exists as an anti-parallel homodimer. This gene is localized to human chromosome 21q22.1.
면역원
melanocortin 2 receptor accessory protein recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
MRAP (melanocortin 2 receptor accessory protein) is responsible for the transport of melanocortin 2 receptor (MC2R) from endoplasmic reticulum (ER) to the cell membrane. The antiparallel homodimer of MRAP interacts with MC2R at ER, and ensures its correct folding and transport to the cell surface. MRAP present at the cell membrane, interacts with adrenocorticotropic hormone (ACTH), and is involved in ACTH signaling pathway. Mutations in this gene cause familial glucocorticoid deficiency type 2 (FGD2), which is an autosomal recessive disorder. FGD2 presents itself in neonates and during late childhood, and is characterized by hypoglycaemia, hyperpigmentation and seizure. MRAP might also control appetite by regulating MC4R (melanocortin 2 receptor) activity in hypothalamus.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST72231
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Louise A Metherell et al.
Nature genetics, 37(2), 166-170 (2005-01-18)
Familial glucocorticoid deficiency (FGD), or hereditary unresponsiveness to adrenocorticotropin (ACTH; OMIM 202200), is an autosomal recessive disorder resulting from resistance to the action of ACTH on the adrenal cortex, which stimulates glucocorticoid production. Affected individuals are deficient in cortisol and
C R Hughes et al.
The Journal of clinical endocrinology and metabolism, 95(7), 3497-3501 (2010-04-30)
Familial glucocorticoid deficiency (FGD) is an autosomal recessive disorder characterized by isolated glucocorticoid deficiency. Mutations in the ACTH receptor [melanocortin 2 receptor (MC2R)] or the MC2R accessory protein (MRAP) cause FGD types 1 and 2, respectively. Typically, type 2 patients
V Jain et al.
European journal of endocrinology, 165(6), 987-991 (2011-09-29)
Familial glucocorticoid deficiency (FGD) is a rare autosomal recessive disorder characterised by isolated glucocorticoid deficiency. Mutations in the ACTH receptor/melanocortin 2 receptor (MC2R), the MC2R accessory protein (MRAP) or the STAR protein (STAR) cause FGD types 1, 2 and 3
T V Novoselova et al.
The Journal of endocrinology, 217(1), R1-11 (2013-02-19)
The melanocortin receptor (MCR) family consists of five G-protein-coupled receptors (MC1R-MC5R) with diverse physiological roles. MC1R controls pigmentation, MC2R is a critical component of the hypothalamic-pituitary-adrenal axis, MC3R and MC4R have a vital role in energy homeostasis and MC5R is
H Rumié et al.
European journal of endocrinology, 157(4), 539-542 (2007-09-26)
Familial glucocorticoid deficiency (FGD) is a rare inherited disorder which may be caused by mutations in the ACTH receptor (melanocortin 2 receptor, MC2R) named FGD type 1 or by mutations in the MC2R accessory protein (MRAP) named FGD type 2.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.