HPA011014

Anti-GLIPR1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-GliPR 1, Anti-Glioma pathogenesis-related protein 1 precursor, Anti-RTVP-1 protein
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA011014
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:20- 1:50
• 면역원 서열: NEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDF
• UniProt 수납 번호: P48060
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GLIPR1(11010)

설명

일반 설명

Glioma pathogenesis-related protein 1 (GLIPR1) is a multifunctional protein which was first recognized in human glioblastomas. It resides in endoplasmic reticulum (ER) and vesicles in cytoplasm. It is a transmembrane protein with its C-terminal spanning the membrane, and has a signal peptide at its N-terminal. It belongs to the CAP (cysteine-rich secretory proteins, antigen 5 and pathogenesis-related 1 proteins) family of proteins, and thus, contains the cysteine-rich CAP domain. GLIPR1 exists as three isoforms, namely, GLIPR1, GLIPR1-like 1 (GLIPR1L1) and GLIPR1-like 2 (GLIPR1L2). GLIPR1 and GLIPR1L2 have a wide range of tissue expression, whereas GLIPR1L1 is predominantly expressed in testis.

면역원

Glioma pathogenesis-related protein 1 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

Glioma pathogenesis-related protein 1 (GLIPR1) is involved in cell cycle, tumorigenesis and apoptosis. It acts as an oncogene in glioblastoma and gliomas, and is overexpressed in the same. It is also unregulated in acute myeloid leukemia (AML), and may facilitate the proliferation of AML cells. Its expression levels are positively correlated with metastasis of tumors in case of astrocytic brain malignancies. Studies suggest that GLIPR1 acts as a tumor suppressor gene in prostate cancer, and its expression is suppressed in prostate cancer cells as compared to normal prostate cells. The expression of this gene is induced by the tumor suppressor gene p53 as well as DNA damage-causing substances such as irradiation. It is an HIV-1 dependency factor (HDF), and it is overexpressed during initial stages of HIV-1 (human immunodeficiency virus-1) infection.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71999

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)