HPA010773

Anti-LRIG3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-LIG-3, Anti-Leucine-rich repeats and immunoglobulin-like domains protein 3 precursor
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA010773
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• 면역원 서열: NLCLNKSSLDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPN
• UniProt 수납 번호: Q6UXM1
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... LRIG3(121227)

설명

일반 설명

LRIG3 (leucine-rich repeats and immunoglobulin-like domains 3) belongs to a family of integral plasma membrane proteins called LRIG. It is a transmembrane glycol-protein, which consists of an extracellular domain of leucine-rich repeats, three immunoglobulin-like domains and an intracellular region. The gene to this protein is located on human chromosome 12q13.2. LRIG3 mRNA is predominantly expressed in thyroid, skin and stomach, and is least expressed in heart and blood.

면역원

Leucine-rich repeats and immunoglobulin-like domains protein 3 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

LRIG3 (leucine-rich repeats and immunoglobulin-like domains 3) is a cytokine. Its function is not yet fully known. It is either influenced by or involved in influencing the pattern of tumor specific markers in precancerous and cancerous cells. Its expression is also linked with the events in cervical intraepithelial neoplasia (CIN), as well as with the use of hormonal contraceptives. LRIG3 gene lies within the region which is up-regulated in certain types of glioblastomas. Hence, this gene is linked with the pathophysiology and prognosis of glioblastoma. Studies show that over-expression of this gene leads to induction of apoptosis and inhibition of proliferation and invasion in bladder cancer cells. LRIG3 regulates the expression of Netrin1 in the epithelium of otic vesicle. This way, it mediates the formation of semicircular canal.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72023

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)