생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
75 kDa
종 반응성
human, horse, rat
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... GLE1(2733)
관련 카테고리
면역원
Synthetic peptide directed towards the N terminal region of human GLE1
애플리케이션
Anti-GLE1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
생화학적/생리학적 작용
GLE1 is required for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm. It may be involved in the terminal step of the mRNA transport through the nuclear pore complex (NPC). Mutations in GLE1 result in a fetal motoneuron disease.
서열
Synthetic peptide located within the following region: LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Heidi O Nousiainen et al.
Nature genetics, 40(2), 155-157 (2008-01-22)
The most severe forms of motoneuron disease manifest in utero are characterized by marked atrophy of spinal cord motoneurons and fetal immobility. Here, we report that the defective gene underlying lethal motoneuron syndrome LCCS1 is the mRNA export mediator GLE1.
J L Watkins et al.
Proceedings of the National Academy of Sciences of the United States of America, 95(12), 6779-6784 (1998-06-17)
The mechanism of mRNA export is a complex issue central to cellular physiology. We characterized previously yeast Gle1p, a protein with a leucine-rich (LR) nuclear export sequence (NES) that is essential for poly(A)+ RNA export in Saccharomyces cerevisiae. To characterize
Frederic Kendirgi et al.
Molecular biology of the cell, 16(9), 4304-4315 (2005-07-08)
Translocation of messenger RNAs through the nuclear pore complex (NPC) requires coordinated physical interactions between stable NPC components, shuttling transport factors, and mRNA-binding proteins. In budding yeast (y) and human (h) cells, Gle1 is an essential mRNA export factor. Nucleocytoplasmic
Frederic Kendirgi et al.
The Journal of cell biology, 160(7), 1029-1040 (2003-04-02)
Gle1 is required for mRNA export in yeast and human cells. Here, we report that two human Gle1 (hGle1) isoforms are expressed in HeLa cells (hGle1A and B). The two encoded proteins are identical except for their COOH-terminal regions. hGle1A
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.