생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
39 kDa
종 반응성
dog, human, rabbit, bovine, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... LGALS8(3964)
일반 설명
LGALS8 (lectin, galactoside-binding, soluble, 8) encodes a protein that belongs to galectin family and is predominantly expressed in tumoral tissues and may be involved in integrin-like cell interactions.
The previously assigned protein identifier Q9BXC8 has been merged into O00214. Full details can be found on the UniProt database.
The previously assigned protein identifier Q9BXC8 has been merged into O00214. Full details can be found on the UniProt database.
면역원
Synthetic peptide directed towards the C terminal region of human LGALS8
애플리케이션
Anti-LGALS8 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
생화학적/생리학적 작용
Gal-8 activates Rho signaling in TM cells and hence facilitates the regulation of cytoskeletal rearrangement in trabecular meshwork cells. Galectin-8 interacts with integrin and modulates its interaction with the extracellular matrix and hence inhibits cell adhesion and induces apoptosis. Additionally, it also has a role in modulating cell adhesion and cell growth.
서열
Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
PloS one, 7(9), e44400-e44400 (2012-09-14)
The trabecular meshwork (TM) cell-matrix interactions and factors that influence Rho signaling in TM cells are thought to play a pivotal role in the regulation of aqueous outflow. The current study was designed to evaluate the role of a carbohydrate-binding
Glycoconjugate journal, 19(7-9), 517-526 (2004-02-06)
Galectin-8 belongs to the family of tandem-repeat type galectins. It consists as several isoforms, each made of two domains of approximately 140 amino-acids, both having a carbohydrate recognition domain (CRD). These domains are joined by a 'link peptide' of variable
Journal of cell science, 113 ( Pt 13), 2385-2397 (2000-06-15)
The interaction of cells with the extracellular matrix regulates cell adhesion, motility, growth, survival and differentiation through integrin-mediated signal transduction. Here we demonstrate that galectin-8, a secreted mammalian (beta)-galactoside binding protein, inhibits adhesion of human carcinoma (1299) cells to plates
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.