AV48836

Anti-METTL2B (AB1) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-FLJ11350, Anti-FLJ12760, Anti-METL, Anti-METTL2, Anti-METTL2A, Anti-Methyltransferase like 2B, Anti-PSENIP1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 43 kDa
• 종 반응성: horse, human, pig, bovine, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_060866
• UniProt 수납 번호: Q6P1Q9
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... METTL2B(55798)

설명

일반 설명

METTL2B codes for methyltransferase like 2B that is involved in tRNA methylation.
Rabbit Anti-METTL2B antibody recognizes human, mouse, rat, canine, zebrafish, and bovine METTL2B.

면역원

Synthetic peptide directed towards the N terminal region of human METTL2B

애플리케이션

Rabbit Anti-METTL2B antibody is suitable for western blot applications at a concentration of 1 μg/ml.

생화학적/생리학적 작용

METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

서열

Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable