추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
164 kDa
종 반응성
rabbit, guinea pig, rat, mouse, bovine, horse, human, dog
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MAP3K1(4214)
관련 카테고리
일반 설명
Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin (MAP3K1) is a serine/threonine kinase that regulates cell signaling. It interacts with Axin1 and is involved in Wnt signaling. Genetic variations in MAP3K1 have been linked to breast cancer risk and sex development disorders.
Rabbit Anti-MAP3K1 antibody recognizes human, mouse, rat, bovine, and rabbit MAP3K1.
Rabbit Anti-MAP3K1 antibody recognizes human, mouse, rat, bovine, and rabbit MAP3K1.
면역원
Synthetic peptide directed towards the C terminal region of human MAP3K1
애플리케이션
Rabbit Anti-MAP3K1 antibody is suitable for western blot applications at a concentration of 1μg/ml.
생화학적/생리학적 작용
MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-983 AC008937.7 118022-119004 c 984-1536 AF042838.1 426-978 1537-1653 AC008937.7 68621-68737 c 1654-1802 AC008937.7 68100-68248 c 1803-2870 AF042838.1 1245-2312 2871-4167 AC008937.7 51211-52507 c 4168-4758 BU194120.1 127-717 4759-5154 DA889202.1 164-559 5155-7355 AC008937.7 38082-40282 c 7356-7522 AA602425.1 1-167 c
서열
Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Lilian Jara et al.
Breast cancer research and treatment, 137(2), 559-569 (2012-12-12)
Genome-Wide Association Studies have identified several loci associated with breast cancer (BC) in populations of different ethnic origins. One of the strongest associations was found in the FGFR2 gene, and MAP3K1 has been proposed as a low-penetrance BC risk factor.
Ser Sue Ng et al.
Biological chemistry, 391(2-3), 171-180 (2010-02-05)
A central point of regulation in the Wnt/beta-catenin signalling pathway is the formation of the beta-catenin destruction complex. Axin1, an essential negative regulator of Wnt signalling, serves as a scaffold within this complex and is critical for rapid turnover of
Alexander Pearlman et al.
American journal of human genetics, 87(6), 898-904 (2010-12-07)
Investigations of humans with disorders of sex development (DSDs) resulted in the discovery of many of the now-known mammalian sex-determining genes, including SRY, RSPO1, SOX9, NR5A1, WT1, NR0B1, and WNT4. Here, the locus for an autosomal sex-determining gene was mapped
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.