AV48240

Anti-DRG1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Developmentally regulated GTP binding protein 1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 26 kDa
• 종 반응성: horse, human, rabbit, dog, guinea pig, rat, bovine, mouse
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_004138
• UniProt 수납 번호: Q9Y295
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... DRG1(4733)

설명

일반 설명

Developmentally regulated GTP binding protein 1 (DRG1) is a a guanine nucleotide binding protein that functions as a potassium-dependent GTPase. It is upregulated by Lerepo4.
Rabbit Anti-DRG1 antibody recognizes human, mouse, rat, bovine, zebrafish, chicken, and rabbit DRG1.

면역원

Synthetic peptide directed towards the middle region of human DRG1

애플리케이션

Rabbit Anti-DRG1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

생화학적/생리학적 작용

DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.

서열

Synthetic peptide located within the following region: VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable