콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV46887

Sigma-Aldrich

Anti-TSPAN12 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-NET-2, Anti-TM4SF12, Anti-Tetraspanin 12

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

35 kDa

종 반응성

mouse, dog, guinea pig, rat, bovine, horse, human, rabbit

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... TSPAN12(23554)

면역원

Synthetic peptide directed towards the middle region of human TSPAN12

애플리케이션

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.

생화학적/생리학적 작용

TSPAN12 (tetraspanin 12) gene encodes a multi-pass membrane protein that belongs to tetraspanin family. TSPAN12 interacts with ADAM10 and stimulates its maturation and thereby facilitates ADAM10-dependent proteolysis of amyloid precursor protein (APP). In cancer cells, knockdown of TSPAN12 decreases membrane type-1 matrix metalloproteinase (MT1-MMP) proteolytic functions. Mutation in TSPAN12 gene results in autosomal-dominant familial exudative vitreoretinopathy.

서열

Synthetic peptide located within the following region: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Guohua Ji et al.
Molecules and cells, 42(7), 557-567 (2019-08-01)
TSPAN12, a member of the tetraspanin family, has been highly connected with the pathogenesis of cancer. Its biological function, however, especially in ovarian cancer (OC), has not been well elucidated. In this study, The Cancer Genome Atlas (TCGA) dataset analysis
James A Poulter et al.
American journal of human genetics, 86(2), 248-253 (2010-02-18)
Familial exudative vitreoretinopathy (FEVR) is an inherited blinding disorder of the retinal vascular system. Although mutations in three genes (LRP5, FZD4, and NDP) are known to cause FEVR, these account for only a fraction of FEVR cases. The proteins encoded
Daosong Xu et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 23(11), 3674-3681 (2009-07-10)
Using mass spectrometry, we identified ADAM10 (a membrane-associated metalloproteinase) as a partner for TSPAN12, a tetraspanin protein. TSPAN12-ADAM10 interaction was confirmed by reciprocal coimmunoprecipitation in multiple tumor cell lines. TSPAN12, to a greater extent than other tetraspanins (CD81, CD151, CD9
Marc A Lafleur et al.
Molecular biology of the cell, 20(7), 2030-2040 (2009-02-13)
Membrane type-1 matrix metalloproteinase (MT1-MMP) supports tumor cell invasion through extracellular matrix barriers containing fibrin, collagen, fibronectin, and other proteins. Here, we show that simultaneous knockdown of two or three members of the tetraspanin family (CD9, CD81, and TSPAN12) markedly

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.