콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV46881

Sigma-Aldrich

Anti-LETM1 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Leucine zipper-EF-hand containing transmembrane protein 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

60 kDa

종 반응성

dog, mouse, horse, guinea pig, bovine, human, rat

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... LETM1(3954)

면역원

Synthetic peptide directed towards the middle region of human LETM1

애플리케이션

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

생화학적/생리학적 작용

LETM1 (leucine zipper-EF-hand containing transmembrane protein 1) gene encodes a single-pass membrane protein localized in the inner mitochondrial membrane. It plays a pivotal role in maintaining the mitochondrial tubular shape as well as cristae organization. It also facilitates the normal mitochondrial morphology and cellular viability. Mutation in LETM1 gene leads to Wolf-Hirschhorn syndrome.

서열

Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Kai Stefan Dimmer et al.
Human molecular genetics, 17(2), 201-214 (2007-10-11)
Wolf-Hirschhorn syndrome (WHS) is a complex congenital syndrome caused by a monoallelic deletion of the short arm of chromosome 4. Seizures in WHS have been associated with deletion of LETM1 gene. LETM1 encodes for the human homologue of yeast Mdm38p
Xiaogang Zhang et al.
Cerebral cortex (New York, N.Y. : 1991), 24(10), 2533-2540 (2013-05-07)
Leucine zipper-EF-hand containing transmembrane protein 1 (Letm1) is a mitochondrial protein that is associated with seizure attacks in Wolf-Hirschhorn syndrome. This study aimed to investigate the expression pattern of Letm1 in patients with temporal lobe epilepsy (TLE) and pilocarpine-induced rat
Shoko Tamai et al.
Journal of cell science, 121(Pt 15), 2588-2600 (2008-07-17)
LETM1 is located in the chromosomal region that is deleted in patients suffering Wolf-Hirschhorn syndrome; it encodes a homolog of the yeast protein Mdm38 that is involved in mitochondrial morphology. Here, we describe the LETM1-mediated regulation of the mitochondrial volume

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.