콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV44247

Sigma-Aldrich

Anti-MICA antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-DAQB-48K1.7, Anti-MGC111087, Anti-MHC class I polypeptide-related sequence A, Anti-PERB11.1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

42 kDa

종 반응성

human

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... MICA(4276)

면역원

Synthetic peptide directed towards the middle region of human MICA

애플리케이션

Anti-MICA antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

생화학적/생리학적 작용

MHC Class I polypeptide-related sequences A and B (MICA and MICB) are surface glycoproteins expressed constitutively on the enterocytes. They act as ligands for the natural killer group 2, member D (NKG2D) immunoreceptor activation. MICA binds NKG2D receptor and activates the CD8+T cells. Tissue damage or increased expression of MICA results in auto-antibodies detected in early-onset systemic lupus erythematosus and celiac disease.

서열

Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Antonio López-Vázquez et al.
BMC medicine, 12, 34-34 (2014-02-26)
Overexpression of autologous proteins can lead to the formation of autoantibodies and autoimmune diseases. MHC class I polypeptide-related sequence A (MICA) is highly expressed in the enterocytes of patients with celiac disease, which arises in response to gluten. The aim
Zhenpeng Dai et al.
The Journal of experimental medicine, 206(4), 793-805 (2009-03-18)
The NKG2D receptor stimulates natural killer cell and T cell responses upon engagement of ligands associated with malignancies and certain autoimmune diseases. However, conditions of persistent NKG2D ligand expression can lead to immunosuppression. In cancer patients, tumor expression and shedding
S Bahram et al.
Proceedings of the National Academy of Sciences of the United States of America, 91(14), 6259-6263 (1994-07-05)
Major histocompatibility complex (MHC) class I genes typically encode polymorphic peptide-binding chains which are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells. They constitute diverse gene families in different species and include the numerous so-called
Natasja Nielsen et al.
Immunology, 142(4), 581-593 (2014-03-29)
Rheumatoid arthritis (RA) is an autoimmune disease characterized by chronic inflammation and synovial hyperplasia leading to progressive joint destruction. Fibroblast-like synoviocytes (FLS) are central components of the aggressive, tumour-like synovial structure termed pannus, which invades the joint space and cartilage.

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.