AV43931

Anti-SLC39A6 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-LIV-1, Anti-Solute carrier family 39 (Zinc transporter), member 6
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 48 kDa
• 종 반응성: human, mouse, rat, sheep, horse, dog, bovine, rabbit
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_036451
• UniProt 수납 번호: Q13433-2
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SLC39A6(25800)

설명

일반 설명

Solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 (SLC39A6, LIV1, ZIP6) is a mediator of zinc (Zn²⁺) transport and intracellular zinc homeostasis. SLC39A6/LIV1 is involves in important processes such as epithelial-to-mesenchymal transition (EMT) in human pancreatic, breast, and prostate cancer cells. SLC39A6/LIV1 has been shown to be a critical mediator responsible for HDACi-induced apoptosis.

특이성

Anti-SLC39A6 polyclonal antibody reacts with bovine, canine, human, mouse, and rat solute carrier family 39 (Zinc transporter), member 6 proteins.

면역원

Synthetic peptide directed towards the middle region of human SLC39A6

애플리케이션

Anti-SLC39A6 polyclonal antibody is used to tag solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 in intracellular zinc homeostasis, epithelial-to-mesenchymal transition (EMT) in cancer cells, and in HDACi-induced apoptosis.

생화학적/생리학적 작용

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.

서열

Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable