생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
39 kDa
종 반응성
rat, mouse, human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... DND1(373863)
일반 설명
Dead end homolog 1 (zebrafish) is an RNA binding protein found in primordial germ cells during embryogenesis. DND1 is essential for germ cell survival. Dnd1 appears to have a critical role in germ-cell and germ cell-tumor development. Dnd1 acts, at least in part, by protecting certain mRNAs from micro-RNA (miRNA)-mediated repression.
특이성
Anti-DND1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine dead end homolog 1 proteins.
면역원
Synthetic peptide directed towards the C terminal region of human DND1
애플리케이션
Anti-DND1 polyclonal antibody is used to tag dead end homolog 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of dead end homolog 1 proteins in germ-cell and germ cell-tumor development, especially at the level of miRNA mediated repression of mRNA transcription.
생화학적/생리학적 작용
DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration
서열
Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Characterization of potential spermatogonia biomarker genes in the European eel (Anguilla anguilla).
Marta Blanes-García et al.
Fish physiology and biochemistry (2024-04-19)
Identification of specific molecular markers for spermatogonial stem cells in teleost is crucial for enhancing the efficacy of reproductive biotechnologies in aquaculture, such as transplantation and surrogate production in fishes. Since it is not yet possible to distinguish spermatogonial stem
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.