AV40257

Anti-RBMy1A1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-RBM1, Anti-RBM2, Anti-RBMY, Anti-RNA binding motif protein, Y-linked, family 1, member A1, Anti-YRRM1, Anti-YRRM2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 41 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_001007527
• UniProt 수납 번호: Q15414
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... RBMY1A1(5940)

설명

일반 설명

RNA binding motif protein, γ-linked, family 1, member A1 (RBMy1A1, γRRM1, γRRM2) is a germ-cell specific nuclear RNA-binding protein involves in spermatogenesis. RBMγ binds to RNA stem-loops capped by a C(A)/(U)CAA pentaloops and participates in splicing within the testis by modulating the activity of constitutively expressed splicing factors.

특이성

Anti-RBMy1A1 polyconal antibody reacts with chicken, human, mouse, rat, canine, and bovine RNA binding motif protein, γ-linked, family 1, member A1 proteins.

면역원

Synthetic peptide directed towards the N terminal region of human RBMY1A1

애플리케이션

Anti-RBMy1A1 polyconal antibody is used to tag RNA binding motif protein, γ-linked, family 1, member A1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA binding motif protein, γ-linked, family 1, member A1 in spermatogenesis.

생화학적/생리학적 작용

RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

서열

Synthetic peptide located within the following region: MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable