콘텐츠로 건너뛰기
Merck
모든 사진(2)

문서

AV40125

Sigma-Aldrich

Anti-SIRT5 (AB2) antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

33 kDa

종 반응성

human, goat

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SIRT5(23408)

일반 설명

SIRT5 (Sirtuin 5) is a mitochondrial matrix protein belonging to the class III of the sirtuin family. It is localized inside the mitochondria and within the cytosol and nucleus. The protein is widely expressed in the brain, heart, liver and kidney. It is composed of very short amino and carboxyl terminal sequences flanking region with the conserved, catalytic sirtuin center domain.The previously assigned protein identifier Q5T295 has been merged into Q9NXA8. Full details can be found on the UniProt database.

면역원

Synthetic peptide directed towards the C terminal region of human SIRT5

애플리케이션

Anti-SIRT5 (AB2) antibody produced in rabbit is suitable for western blot applications.

생화학적/생리학적 작용

SIRT5 (Sirtuin 5) is associated with metabolism and aging process. It has been reported in a study that SIRT5 influences urea cycle pathway by NAD-dependent deacetylation and subsequent activation of carbamoyl phosphate synthetase 1 (CPS1), which plays a vital role in the initial step of urea cycle for the detoxification and removal of ammonia. In non-small cell-lung cancer cells, SIRT5 contributions have also been observed for the cancer cell growth and drug resistance. Study shows that SIRT5 may possess oncogenic property.

서열

Synthetic peptide located within the following region: HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Takashi Nakagawa et al.
Cell, 137(3), 560-570 (2009-05-05)
Sirtuins are NAD-dependent protein deacetylases that connect metabolism and aging. In mammals, there are seven sirtuins (SIRT1-7), three of which are associated with mitochondria. Here, we show that SIRT5 localizes in the mitochondrial matrix and interacts with carbamoyl phosphate synthetase
Xiao-bin Lv et al.
Scientific reports, 5, 17940-17940 (2015-12-15)
SUN2, a key component of LINC (linker of nucleoskeleton and cytoskeleton) complex located at the inner nuclear membrane, plays unknown role in lung cancer. We found that SUN2 expression was decreased in lung cancer tissue compared with paired normal tissues

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.