AV39728

Anti-ATOH8 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Atonal homolog 8 (Drosophila)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 35 kDa
• 종 반응성: human, rat, horse, bovine, rabbit, dog, pig
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_116216
• UniProt 수납 번호: Q96SQ7
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ATOH8(84913)

설명

일반 설명

Atonal homolog 8 (Drosophila) (ATOH8) is a basic helix-loop-helix (bHLH) transcription factor involved in the vertebrae tissue-specific differentiation of the nervous system, kidneys, pancreas, retina and muscle during embryogenesis.

특이성

Anti-ATOH8 polyclonal antibody reacts with canine, human, mouse, and rat atonal homolog 8 proteins.

면역원

Synthetic peptide directed towards the N terminal region of human ATOH8

애플리케이션

Anti-ATOH8 polyclonal antibody is used to tag atonal homolog 8 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of Atonal homolog 8 in tissue-specific differentiation during embryogenesis.

생화학적/생리학적 작용

The function of ATOH8 remains unknown.

서열

Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable