AV39509

Anti-FOXA2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Forkhead box A2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 48 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_068556
• UniProt 수납 번호: Q9Y261
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... FOXA2(3170)

설명

일반 설명

Forkhead proteins are transcription factors that contain a DNA binding motif, winged helix, called a forkhead box. These proteins regulate genes involved in major cell processes such as embryonic development, cell proliferation and differentiation. Forkhead box A2 (FOXA2, hepatic nuclear factor 3β, HNF3), a member of the forkhead regulatory factors, interacts with the androgen receptors to regulate prostate and epididymal genes and is as an essential activator of genes that function in multiple pathways governing insulin secretion.

특이성

Anti-FOXA2 (AB2) polyclonal antibody reacts with human, mouse, rat, and canine forkhead box A2 (hepatic nuclear factor 3β, HNF3) proteins.

면역원

Synthetic peptide directed towards the C terminal region of human FOXA2

애플리케이션

Anti-FOXA2 (AB2) polyclonal antibody is used to tag forkhead box A2 protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of forkhead box A2 protein in regulation of gene sets involved with processes such as reproduction and insulin secretion.

생화학적/생리학적 작용

FOXA2 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

서열

Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable