생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
54 kDa
종 반응성
rat, pig, bovine, mouse, horse, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... TRIM62(55223)
일반 설명
Tripartite motif containing 62 (TRIM62) is a cytoplasmic protein that functions as a RING finger E3 ubiquitin ligase. It is known to catalyze self-ubiquination.
Rabbit Anti-TRIM62 antibody recognizes canine, human, mouse, rat, and bovine TRIM62.
Rabbit Anti-TRIM62 antibody recognizes canine, human, mouse, rat, and bovine TRIM62.
면역원
Synthetic peptide directed towards the N terminal region of human TRIM62
애플리케이션
Rabbit Anti-TRIM62 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
생화학적/생리학적 작용
TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.
서열
Synthetic peptide located within the following region: CSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Fang Huang et al.
Biochemical and biophysical research communications, 432(2), 208-213 (2013-02-14)
TRIM62, also named DEAR1, is a member of the TRIM/RBCC family, which includes proteins with conserved RING finger, B-box and coiled-coil domains. Several reports have identified a role for this family in cancer, retroviral infection and innate immunity. In this
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.