AV37665

Anti-GPC3 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Glypican 3
• UNSPSC 코드: 12352203

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: lyophilized powder
• 분자량: 64 kDa
• 종 반응성: guinea pig, horse, canine, rat, mouse, rabbit, bovine, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_004475
• UniProt 수납 번호: P51654
• 저장 온도: −20°C
• 유전자 정보: human ... GPC3(2719)

설명

일반 설명

Glypican 3 (GPC3), whose gene is associated with Simpson-Golabi-Behmel syndrome, is a heparin sulfate proteoglycan that is anchored to cell-surfaces via glycosylphosphatidylinositol (GPI). Overexpression of glypican 3 occurs in hepatocellular carcinomas (HCC). The silencing of glypican 3 expression leads to apoptosis in HCC.

특이성

Anti-GPC3 polyclonal antibody reacts with canine, bovine, human, mouse, and rat glypican 3 proteins.

면역원

The immunogen for anti-GPC3 antibody: synthetic peptide derected towards the middle region of human GPC3

애플리케이션

Anti-GPC3 polyclonal antibody is used to tag glypican 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe in cancer diagnosis to detect the presence of glypican 3 in hepatocellular carcinomas (HCC).

서열

Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

물리적 형태

Lyophilized from PBS buffer with 2% sucrose

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable