생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
43 kDa
종 반응성
human, guinea pig, rat
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CBX8(57332)
일반 설명
CBX8 is a polycomb group protein that associates with other proteins such as TIP60 and MLL-AF9. CBX8 also forms a part of the PRC1 complexes. It regulates fibroblast proliferation and cell survival. Furthermore, studies have reported that CBX8 is needed for MLL-AF9-induced transcription and leukemogenesis.
Rabbit Anti-CBX8 (AB1) antibody recognizes bovine, human, mouse, rat, and canine CBX8.
Rabbit Anti-CBX8 (AB1) antibody recognizes bovine, human, mouse, rat, and canine CBX8.
면역원
Synthetic peptide directed towards the middle region of human CBX8
애플리케이션
Rabbit Anti-CBX8 (AB1) antibody can be used for western blot applications at a concentration of 0.25 μg/ml.
생화학적/생리학적 작용
CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function.
서열
Synthetic peptide located within the following region: QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRH
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Jiaying Tan et al.
Cancer cell, 20(5), 563-575 (2011-11-19)
Chromosomal translocations involving the mixed lineage leukemia (MLL) gene lead to the development of acute leukemias. Constitutive HOX gene activation by MLL fusion proteins is required for MLL-mediated leukemogenesis; however, the underlying mechanisms remain elusive. Here, we show that chromobox
Nikolaj Dietrich et al.
The EMBO journal, 26(6), 1637-1648 (2007-03-03)
The Polycomb group (PcG) proteins are essential for embryogenesis, and their expression is often found deregulated in human cancer. The PcGs form two major protein complexes, called polycomb repressive complexes 1 and 2 (PRC1 and PRC2) whose function is to
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.