AV32264

Anti-ETV5 (AB1) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Ets variant gene 5 (Ets-related molecule)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 58 kDa
• 종 반응성: rat, bovine, horse, guinea pig, mouse, rabbit, dog, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_004445
• UniProt 수납 번호: P41161
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ETV5(2119)

설명

일반 설명

ETV5 loss has been linked to spermatogonial stem cell loss and infertility. Rabbit Anti-ETV5 (AB2) antibody recognizes human, mouse, rat, bovine, and canine ETV5.

Rabbit polyclonal anti-ETV5 antibody reacts with human, mouse, rat, bovine, and canine ETS variant gene 5 transcription factors.

Transcription factor ets variant gene 5 (ETV5/ERM) has various function in male reproduction. ETV5 regulates sertolic cell chemokines involved in stem/progenitor spermatogonia maintenance and is essential for spermatogonial stem cell (SSC) self-renewal.

면역원

Synthetic peptide directed towards the N terminal region of human ETV5

애플리케이션

Rabbit Anti-ETV5 (AB1) antibody can be used for western blot applications at 1μg/ml.

Rabbit polyclonal anti-ETV5 antibody is used to tag ETS variant gene 5 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of ETS variant gene 5 in spermatogonia maintenance and self-renewal.

생화학적/생리학적 작용

ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer

서열

Synthetic peptide located within the following region: AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable