생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
57 kDa
종 반응성
bovine, rat, horse, rabbit, human, guinea pig, mouse, dog
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ELF2(1998)
일반 설명
ELF2 is a transcription factor that belongs to the Eph ligand family of proteins. This transcription factor is known to be expressed in the hind brain and newly forming somites of the mouse embryo.
Rabbit Anti-ELF2 antibody recognizes chicken, human, mouse, rat, and canine ELF2.
Rabbit Anti-ELF2 antibody recognizes chicken, human, mouse, rat, and canine ELF2.
면역원
Synthetic peptide directed towards the N terminal region of human ELF2
애플리케이션
Rabbit Anti-ELF2 antibody can be used for western blot assays at concentration of 0.5μg/ml.
생화학적/생리학적 작용
The ELF2 gene encodes a protein that physically interacts with AML1 and mediates opposing effects on AML1-mediated transcription of the B cell-specific blk gene.
서열
Synthetic peptide located within the following region: TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
A D Bergemann et al.
Molecular and cellular biology, 15(9), 4921-4929 (1995-09-01)
The Eph receptors are the largest known family of receptor tyrosine kinases and are notable for distinctive expression patterns in the nervous system and in early vertebrate development. However, all were identified as orphan receptors, and only recently have there
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.