AV30118

Anti-YEATS4 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-YEATS domain containing 4
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 25 kDa
• 종 반응성: bovine, dog, rabbit, mouse, horse, human, guinea pig, rat, sheep
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_006521
• UniProt 수납 번호: O95619
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... YEATS4(8089)

설명

일반 설명

YEATS4 is an oncogene that negatively regulates the p21-p53 pathway. Amplification of YEATS4 has been linked to the pathogenesis of non-small cell lung cancers (NSCLC).
Rabbit Anti-YEATS4 antibody recognizes chicken, bovine, zebrafish, canine, human, mouse, and rat YEATS4.

면역원

Synthetic peptide directed towards the middle region of human YEATS4

애플리케이션

Rabbit Anti-YEATS4 antibody can be used for western blot (0.5μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) assays.

생화학적/생리학적 작용

YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

서열

Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable