APREST94131

PrEST Antigen STRC

Prestige Antigens Powered by Atlas Antibodies

• 동의어(들): DFNB16
• UNSPSC 코드: 12352203

속성

• 재조합: expressed in E. coli
• 분석: >80% (SDS-PAGE)
• 형태: buffered aqueous solution
• 분자량: predicted mol wt 30 kDa
• 정제법: immobilized metal affinity chromatography (IMAC)
• 농도: ≥0.5 mg/mL
• 면역원 서열: LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG
• Ensembl | 인체 수납 번호: ENSG00000242866
• UniProt 수납 번호: Q7RTU9
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... STRC(161497)

설명

일반 설명

Recombinant protein fragment of Human STRC with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

애플리케이션

Blocking agent and positive assay control using corresponding antibodies.

물리적 형태

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

제조 메모

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable