APREST84994

PrEST Antigen WNT10B

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• 동의어(들): SHFM6, WNT-12
• UNSPSC 코드: 12352202

속성

• 재조합: expressed in E. coli
• 분석: >80% (SDS-PAGE)
• 형태: buffered aqueous solution
• 분자량: predicted mol wt 25 kDa
• 정제법: immobilized metal affinity chromatography (IMAC)
• 농도: ≥0.5 mg/mL
• 면역원 서열: SLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFS
• Ensembl | 인체 수납 번호: ENSG00000169884
• UniProt 수납 번호: O00744
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... WNT10B(7480)

설명

일반 설명

Recombinant protein fragment of Human WNT10B with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

애플리케이션

Suitable as a blocking agent using corresponding antibodies.

결합

Corresponding Antibody HPA055048.

물리적 형태

Solution in 1 M urea-PBS, pH 7.4

제조 메모

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

법적 정보

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable