재조합
expressed in E. coli
분석
>80% (SDS-PAGE)
형태
buffered aqueous solution
분자량
predicted mol wt 34 kDa
정제법
immobilized metal affinity chromatography (IMAC)
농도
≥0.5 mg/mL
면역원 서열
PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI
Ensembl | 인체 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... MMP9(4318)
일반 설명
Recombinant protein fragment of Human MMP9 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
애플리케이션
Suitable as a blocking agent using corresponding antibodies.
물리적 형태
Solution in 1 M urea-PBS, pH 7.4
제조 메모
The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
법적 정보
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.