Skip to Content
Merck
All Photos(5)

Key Documents

HPA015267

Sigma-Aldrich

Anti-CDK14 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-PFTK1, Anti-Serine/threonine-protein kinase PFTAIRE-1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PFTK1(5218)

General description

CDK14 (cyclin-dependent kinase 14) belongs to a 21 member cyclin dependent kinase gene family. It is also called PFTK1 or PFTAIRE1. This family contains two groups- 10 classical CDKs and the rest 11 are members of a new group. This gene is localized to human chromosome 7q21.13, and has a high expression level in brain, heart, pancreas, kidney, ovaries and testis. In lungs, it is expressed in bronchial and alveolar epithelium.

Immunogen

Serine/threonine-protein kinase PFTAIRE-1 recombinant protein epitope signature tag (PrEST)

Application

Anti-CDK14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

CDK14 (cyclin-dependent kinase 14) facilitates cell division, and also has functions as an oncogene. In hepatocellular carcinoma, it aids in tumor growth and metastasis. It is overexpressed in esophageal squamous cell carcinoma (ESCC), and this is related to poor response to chemotherapy. It has potential as a marker for prognosis as well as response to chemotherapy in ESCC. Studies in mice show that cigarette smoke leads to reduced expression of this protein in both testicular and lung cells. In lungs, this results in decreased β-catenin, resulting in aberrant Wnt signaling. Studies in mice also show that this protein is involved in meiosis and differentiation of neuronal cells. It phosphorylates caldesmon, an actin-binding protein, and thus facilitates the binding of actin molecules, and the formation of stress fibers.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73464

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

T Yang et al.
Gene, 267(2), 165-172 (2001-04-21)
We isolated a novel member of putative Cdc2-related serine/threonine protein kinases from a Hela cell cDNA library. The cDNA encodes a protein of 469 amino acids, sharing 95% identities with the mouse PFTAIRE1 throughout the entire protein sequence. This gene
Daniel Pollack et al.
Toxicology letters, 234(2), 120-130 (2015-02-15)
In this study, DNA arrays have been employed to monitor gene expression patterns in testis of mice exposed to tobacco smoke for 24 weeks and compared to control animals. The results of the analysis revealed significant changes in expression of
H Miyagaki et al.
British journal of cancer, 106(5), 947-954 (2012-02-16)
Recently, PFTK1 was identified as a member of the cyclin-dependent kinase family; however, its expression and clinical significance in oesophageal squamous cell carcinoma (ESCC) have not been evaluated. PFTK1 expression was initially examined by expression microarray in 77 ESCC patients.
Quanbo Ji et al.
Cell death & disease, 8(10), e3103-e3103 (2017-10-13)
Osteosarcoma (OS) has emerged as the most common primary musculoskeletal malignant tumour affecting children and young adults. Cyclin-dependent kinases (CDKs) are closely associated with gene regulation in tumour biology. Accumulating evidence indicates that the aberrant function of CDK14 is involved
Wilson K C Leung et al.
Molecular and cellular biochemistry, 350(1-2), 201-206 (2010-12-25)
Caldesmon (CaD) is an actin-binding protein that is capable of stabilizing actin filaments. Phosphorylation of CaD is widely accepted in the actin cytoskeletal modeling and promotion of cell migration. In this study, we show that CaD is a downstream phosphorylation

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service