Skip to Content
Merck
All Photos(5)

Key Documents

Safety Information

WH0064093M3

Sigma-Aldrich

Monoclonal Anti-SMOC1 antibody produced in mouse

clone 8F10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-SPARC related modular calcium binding 1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
¥81,000

¥81,000

Estimated to ship onApril 14, 2025

All Photos(5)

Select a Size

Change View
100 μG
¥81,000

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

¥81,000

Estimated to ship onApril 14, 2025

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

8F10, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

NM_022137

UniProt accession no.

Q9H4F8

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SMOC1(64093)

General description

SPARC related modular calcium binding 1 (SMOC1) is an extracellular glycoprotein belonging to the SPARC family. It is localized and secreted in bone marrow derived mesenchymal stem cells (BMSCs) stimulated with osteogenic medium (OSM). The protein is expressed in the developing optic stalk, ventral optic cup, and limbs of mouse embryos. It is composed of five domains, an N-terminal follistatin-like (FS) domain, two thyroglobulin-like (TY) domains similar to SMOC, and an extracellular calcium-binding (EC) domain.

Immunogen

SMOC1 (NP_071420, 150 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS

Biochem/physiol Actions

SMOC1 plays an essential role in ocular and limb development. It participates in the regulation of cell-matrix interaction by binding to many cell-surface receptors, the extracellular matrix, growth factors, and cytokines. It also functions in bone morphogenetic proteins (BMP) signaling cascade. Mutation in SMOC1 causes a rare autosomal-recessive disorder, microphthalmia and limb anomalies (MLA).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

WH0064093M3-100UG:

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
08074-8F10
06314-8F10

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ippei Okada et al.
American journal of human genetics, 88(1), 30-41 (2011-01-05)
Microphthalmia with limb anomalies (MLA) is a rare autosomal-recessive disorder, presenting with anophthalmia or microphthalmia and hand and/or foot malformation. We mapped the MLA locus to 14q24 and successfully identified three homozygous (one nonsense and two splice site) mutations in
Hana Abouzeid et al.
American journal of human genetics, 88(1), 92-98 (2011-01-05)
Waardenburg anophthalmia syndrome, also known as microphthalmia with limb anomalies, ophthalmoacromelic syndrome, and anophthalmia-syndactyly, is a rare autosomal-recessive developmental disorder that has been mapped to 10p11.23. Here we show that this disease is heterogeneous by reporting on a consanguineous family, not
Young-Ae Choi et al.
Journal of proteome research, 9(6), 2946-2956 (2010-04-03)
Extracellular matrix proteins have been implicated in the regulation of osteoblast differentiation of bone marrow derived mesenchymal stem cells (BMSCs) through paracrine or autocrine mechanisms. In the current study, we analyzed the secretory protein profiles of BMSCs grown in osteogenic

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service