Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

WH0006279M1

Sigma-Aldrich

Monoclonal Anti-S100A8 antibody produced in mouse

clone 2H2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-60B8AG, Anti-CAGA, Anti-CFAG, Anti-CGLA, Anti-CP10, Anti-L1Ag, Anti-MA387, Anti-MIF, Anti-MRP8, Anti-NIF, Anti-P8, Anti-S100 calcium binding protein A8 (calgranulin A)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2H2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... S100A8(6279)

General description

The gene S100A8 (S100 calcium-binding protein A8) is mapped to human chromosome 1q21. It is also known as myeloid-related protein 8 (MRP8) or calgranulin A. It is a small calcium-binding protein, which is strongly expressed in neutrophils. In presence of cell stimulation, it is also expressed in monocytes, macrophages, platelets and epithelial and endothelial cells. S100A8 protein is present as a homodimer as well as heterodimer. The protein has two EF-hand motifs and one high-affinity Ca2+ binding site.

Immunogen

S100A8 (AAH05928.1, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Biochem/physiol Actions

S100A8 (S100 calcium-binding protein A8) is mainly present at the inflammation site or in the serum during acute and chronic inflammation. It is responsible for neutrophil recruitment, attachment and release from the bone marrow. S100A8 is crucial for sending neutrophils to the site of inflammation in the presence of bacterial infection, lipopolysaccharide and monosodium urate crystals. The protein is also involved in granulocyte and monocyte attachment to endothelium and also their transport across endothelial cells. The S100A8/A9 heterodimer induces monocyte migration and cytokine secretion. In the presence of falciparum malaria, high levels of S100A8 are present in the blood.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

WH0006279M1-100UG:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Up-regulated S100 calcium binding protein A8 in Plasmodium-infected patients correlates with CD4(+)CD25(+)Foxp3 regulatory T cell generation.
Malaria Journal (2015)
mRNA Expression of S100A8 as a Prognostic Marker for Progression of Non-Muscle-Invasive Bladder Cancer.
Ha YS
Korean Journal of Urology (2010)
Secretion of S100A8, S100A9, and S100A12 by Neutrophils Involves Reactive Oxygen Species and Potassium Efflux.
Tardif MR
Journal of immunology research (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service