SAB2108860

Anti-GUCA2A antibody produced in rabbit FITC conjugated

affinity isolated antibody

• Synonym(s): CPT1-M, CPT1M, CPTI, KIAA1670, M-CPT1
• UNSPSC Code: 12352203
• NACRES: NA.45

Properties

• biological source: rabbit
• conjugate: FITC conjugate
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 12 kDa
• species reactivity (predicted by homology): human, mouse, guinea pig, horse, bovine, rat, pig, rabbit, yeast
• concentration: 0.5 mg/mL
• NCBI accession no.: NM_033553
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GUCA2A(2980)

Description

General description

GUCA2A is an endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.

Sequence

Synthetic peptide located within the following region: FAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCE

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable