Skip to Content
Merck
All Photos(1)

Key Documents

Safety Information

SAB2101267

Sigma-Aldrich

Anti-KIRREL antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FLJ10845, Anti-Kin of IRRE like (Drosophila), Anti-MGC129542, Anti-MGC129543, Anti-NEPH1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
¥62,700

¥62,700


Check Cart for Availability
New, lower price on this item!


Select a Size

Change View
100 μL
¥62,700

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

¥62,700


Check Cart for Availability
New, lower price on this item!

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

84 kDa

species reactivity

guinea pig, dog, bovine, rabbit, rat, human, horse, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KIRREL(55243)

Immunogen

Synthetic peptide directed towards the middle region of human KIRREL

Biochem/physiol Actions

KIRREL (NEPH1) is a member of the nephrin-like protein family, which includes NEPH2 and NEPH3. The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration. NEPH1 is a member of the nephrin-like protein family, which includes NEPH2 (MIM 607761) and NEPH3 (MIM 607762). The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2; MIM 604766), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration (Sellin et al., 2003 [PubMed 12424224]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-337 AY302131.1 1-337 338-3211 BC109193.1 1-2874 3212-3609 AK001707.1 1904-2301 3610-3628 BC082969.1 2273-2291

Sequence

Synthetic peptide located within the following region: FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

SAB2101267-50UG:
SAB2101267-100UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service