SAB1412598

ANTI-MUC2 antibody produced in mouse

clone 2A9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MLP, MUC2, SMUC
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2A9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 35.09 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_002457
• UniProt accession no.: Q02817
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MUC2(4583)

Description

General description

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)

Immunogen

MUC2 (NP_002448, 4993 a.a. ~ 5078 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
THCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTV

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable