Skip to Content
Merck
All Photos(5)

Key Documents

Safety Information

HPA038440

Sigma-Aldrich

Anti-SPAG6 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CT141, Anti-Repro-SA-1, Anti-pf16

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
¥92,500

¥92,500


Check Cart for Availability


Select a Size

Change View
100 μL
¥92,500

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

¥92,500


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

AVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SPAG6(9576)

General description

Sperm associated antigen 6 (SPAG6) is a novel cancer-testis antigen, encoded by the gene mapped to human chromosome 10p11.2–p12. The encoded protein is a mammalian orthologue of Chlamydomonas PF16. SPAG6 is localized to the axoneme central apparatus.

Immunogen

sperm associated antigen 6 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SPAG6 antibody produced in rabbit has been used in immunohistochemistry (IHC).

Biochem/physiol Actions

Sperm associated antigen 6 (SPAG6) is an essential protein involved in the assembly and structural integrity of the sperm tail axoneme. It also plays a crucial role in flagellar motility. Knockdown of SPAG6 gene inhibited the growth of malignant myeloid cell lines SKM-1 and K562 via activation of TNF-related apoptosis-inducing ligand (TRAIL) signaling pathway. Elevated expression of SPAG6 is observed in CD34+ cells of myelodysplastic syndromes (MDSs) and acute myelogenous leukemia (AML) patients.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80170

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

HPA038440-100UL:
HPA038440-25UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

SPAG6 and L1TD1 are transcriptionally regulated by DNA methylation in non-small cell lung cancers.
Altenberger C
Molecular Cancer, 16 (2017)
Otitis media in sperm-associated antigen 6 (Spag6)-deficient mice.
Li X
PLoS ONE, 9 (2014)
Chuan Xu et al.
Reproductive biology and endocrinology : RB&E, 20(1), 41-41 (2022-03-03)
Multiple morphological abnormalities of the sperm flagella (MMAF) is a subtype of severe asthenoteratozoospermia with poorly understood genetic etiology. SPAG6 is a core axonemal component that plays a critical role in the formation of cilia and sperm flagella. Previous studies
Corinna Altenberger et al.
Molecular cancer, 16(1), 1-1 (2017-01-18)
DNA methylation regulates together with other epigenetic mechanisms the transcriptional activity of genes and is involved in the pathogenesis of malignant diseases including lung cancer. In non-small cell lung cancer (NSCLC) various tumor suppressor genes are already known to be
SPAG6 silencing inhibits the growth of the malignant myeloid cell lines SKM-1 and K562 via activating p53 and caspase activation-dependent apoptosis.
Yang B
International Journal of Oncology, 46, 649-656 (2015)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service