Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

HPA019544

Sigma-Aldrich

Anti-AGPAT2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-1-AGP acyltransferase 2, Anti-1-AGPAT 2, Anti-1-acyl-sn-glycerol-3-phosphate acyltransferase beta, Anti-LPAAT-beta, Anti-Lysophosphatidic acid acyltransferase beta

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:20-1:50
western blot: 0.04-0.4 μg/mL

immunogen sequence

YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... AGPAT2(10555)

General description

AGPAT2 (1-acylglycerol-3-phosphate O-acyltransferase 2) gene contains six exons, and is located to chromosome 9, region q34.3. It is a novel member of the acyltransferase enzyme family comprising of two conserved motifs, NHX(4)D and EGTR. It is highly expressed in liver, and pancreas. Its expression have also been found in placenta and brain subregions at low extent.

Immunogen

1-acyl-sn-glycerol-3-phosphate acyltransferase beta recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

AGPAT2 (1-acylglycerol-3-phosphate O-acyltransferase 2) is involved in enzymatic activity of phospholipid biosynthesis. It converts lysophosphatidic acid (LPA) to phosphatidic acid (PA) during biosynthesis of glycerophospholipids and triglycerides from glycerol-3-phosphate via catalytic acylation. It also plays a crucial role in regulating the cell proliferation and tumor growth of human osteosarcoma cells.In lipid biosynthesis, it helps to generate phosphatidic acid. Mutation in AGPAT2 causes a rare autosomal recessive disorder, congenital generalized lipodystrophy (CGL) with extreme reduction of white adipose tissue (WAT) mass.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73053

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

HPA019544-25UL:
HPA019544-100UL:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Víctor A Cortés et al.
PloS one, 9(1), e87173-e87173 (2014-02-06)
Congenital generalized lipodystrophy (CGL) is a rare autosomal recessive disorder characterized by extreme reduction of white adipose tissue (WAT) mass. CGL type 1 is the most frequent form and is caused by mutations in AGPAT2. Genetic and clinical studies were
Farbod Rastegar et al.
PloS one, 5(12), e14182-e14182 (2010-12-15)
Osteosarcoma is the most common primary malignancy of bone with poorly characterized molecular pathways important in its pathogenesis. Increasing evidence indicates that elevated lipid biosynthesis is a characteristic feature of cancer. We sought to investigate the role of lysophosphatidic acid
Wasim Haque et al.
Biochemical and biophysical research communications, 327(2), 446-453 (2005-01-05)
Mutations in the gene encoding 1-acylglycerol-3-phosphate-O-acyltransferase 2 (AGPAT2) have been reported in patients with congenital generalized lipodystrophy (CGL). AGPAT2, a 278 amino acid protein, belongs to the acyltransferase enzyme family, and has two conserved motifs, NHX(4)D and EGTR, involved in
Elena Silva et al.
FASEB bioAdvances, 6(1), 1-11 (2024-01-15)
Normal fetal development is critically dependent on optimal nutrient supply by the placenta, and placental amino acid transport has been demonstrated to be positively associated with fetal growth. Mechanistic target of rapamycin (mTOR) is a positive regulator of placental amino
C Eberhardt et al.
The Journal of biological chemistry, 272(32), 20299-20305 (1997-08-08)
Lysophosphatidic acid (1-acyl-sn-glycero-3-phosphate (LPA)) is a phospholipid with diverse biological activities. The mediator serves as an intermediate in membrane phospholipid metabolism but is also produced in acute settings by activated platelets. LPA is converted to phosphatidic acid, itself a lipid

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service