HPA014459

Anti-ST6GAL2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-Alpha 2,6-ST 2, Anti-Beta-galactoside alpha-2,6-sialyltransferase 2, Anti-CMP-N- acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2, Anti-ST6Gal II, Anti-ST6Gal-II, Anti-ST6GalII, Anti-Sialyltransferase 2, Anti-hST6Gal II
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA014459
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunohistochemistry: 1:50- 1:200
• immunogen sequence: PSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQ
• UniProt accession no.: Q96JF0
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ST6GAL2(84620)

Description

General description

The gene ST6GAL2 (ST6 β-galactosamide α-2,6-sialyltranferase 2) belongs to the ST6Gal family that also includes another member, ST6Gal I. It is mainly expressed in embryonic and adult brain. It is also found to be expressed in small intestine and colon. The encoded protein is found to be 529 amino acids long and exhibits 48.9% amino acid sequence similarity with ST6Gal I. The ST6GAL2 gene is mapped to human chromosome 2q11.2-q12.1. It consists of eight exons spanning a length of 85kb. The protein contains type II transmembrane topology. All sialyltransferases of animal origin contain a short N-terminal tail that is cytoplasmic, a transmembrane domain, a stem region, and a catalytic domain with highly conserved motifs called sialylmotifs.

Immunogen

Beta-galactoside alpha-2,6-sialyltransferase 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

The gene (ST6 β-galactosamide α-2,6-sialyltranferase 2) encodes a putative sialyltransferase. It catalyzes the transfer of sialic acid from CMP to an oligosaccharide substrate having Galβ1,4GlcNAc sequence at the nonreducing end of their carbohydrate groups through an α2, 6-linkage. It prefers the LacdiNAc structure as an acceptor substrate over the Galβ1-4GlcNAc structure.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72039

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves