HPA011024
Anti-MRAP antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1
Synonym(s):
Anti-B27, Anti-C21orf61, Anti-FALP, Anti-melanocortin 2 receptor accessory protein
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:50- 1:200
immunogen sequence
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MRAP(56246)
General description
MRAP (melanocortin 2 receptor accessory protein) is a small transmembrane protein which spans the cell membrane once. It is a paralogue of MRAP2. This protein resides in endoplasmic reticulum (ER) and plasma membrane. In adrenal cortex, it is expressed in glucocorticoid producing cells, in zona fasciculate and in the undifferentiated zone. It is also expressed in brain and pituitary. MRAP is composed of 172 amino acids and has a highly conserved N-terminus. Due to alternative splicing, MRAP has two isoforms which differ in their C-termini. These isoforms called MRAPα (19kDa) and MRAPβ (14kDa), exhibit same level of expression in adrenal gland. MRAPα is found predominantly in ER whereas MRAPβ is localized more in the plasma membrane. It exists as an anti-parallel homodimer. This gene is localized to human chromosome 21q22.1.
Immunogen
melanocortin 2 receptor accessory protein recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
MRAP (melanocortin 2 receptor accessory protein) is responsible for the transport of melanocortin 2 receptor (MC2R) from endoplasmic reticulum (ER) to the cell membrane. The antiparallel homodimer of MRAP interacts with MC2R at ER, and ensures its correct folding and transport to the cell surface. MRAP present at the cell membrane, interacts with adrenocorticotropic hormone (ACTH), and is involved in ACTH signaling pathway. Mutations in this gene cause familial glucocorticoid deficiency type 2 (FGD2), which is an autosomal recessive disorder. FGD2 presents itself in neonates and during late childhood, and is characterized by hypoglycaemia, hyperpigmentation and seizure. MRAP might also control appetite by regulating MC4R (melanocortin 2 receptor) activity in hypothalamus.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST72231
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Listings
Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.
JAN Code
HPA011024-100UL:
HPA011024-25UL:
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Louise A Metherell et al.
Nature genetics, 37(2), 166-170 (2005-01-18)
Familial glucocorticoid deficiency (FGD), or hereditary unresponsiveness to adrenocorticotropin (ACTH; OMIM 202200), is an autosomal recessive disorder resulting from resistance to the action of ACTH on the adrenal cortex, which stimulates glucocorticoid production. Affected individuals are deficient in cortisol and
C R Hughes et al.
The Journal of clinical endocrinology and metabolism, 95(7), 3497-3501 (2010-04-30)
Familial glucocorticoid deficiency (FGD) is an autosomal recessive disorder characterized by isolated glucocorticoid deficiency. Mutations in the ACTH receptor [melanocortin 2 receptor (MC2R)] or the MC2R accessory protein (MRAP) cause FGD types 1 and 2, respectively. Typically, type 2 patients
V Jain et al.
European journal of endocrinology, 165(6), 987-991 (2011-09-29)
Familial glucocorticoid deficiency (FGD) is a rare autosomal recessive disorder characterised by isolated glucocorticoid deficiency. Mutations in the ACTH receptor/melanocortin 2 receptor (MC2R), the MC2R accessory protein (MRAP) or the STAR protein (STAR) cause FGD types 1, 2 and 3
T V Novoselova et al.
The Journal of endocrinology, 217(1), R1-11 (2013-02-19)
The melanocortin receptor (MCR) family consists of five G-protein-coupled receptors (MC1R-MC5R) with diverse physiological roles. MC1R controls pigmentation, MC2R is a critical component of the hypothalamic-pituitary-adrenal axis, MC3R and MC4R have a vital role in energy homeostasis and MC5R is
H Rumié et al.
European journal of endocrinology, 157(4), 539-542 (2007-09-26)
Familial glucocorticoid deficiency (FGD) is a rare inherited disorder which may be caused by mutations in the ACTH receptor (melanocortin 2 receptor, MC2R) named FGD type 1 or by mutations in the MC2R accessory protein (MRAP) named FGD type 2.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service