Skip to Content
Merck
All Photos(7)

Key Documents

Safety Information

HPA008297

Sigma-Aldrich

Anti-RPN2 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit, Anti-Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 precursor, Anti-RIBIIR, Anti-RPN-II, Anti-Ribophorin II, Anti-Ribophorin-2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
¥92,500

¥92,500


Estimated to ship onApril 18, 2025



Select a Size

Change View
100 μL
¥92,500

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

¥92,500


Estimated to ship onApril 18, 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RPN2(6185)

General description

Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 2 (RPN2) is a glycoprotein which is a subunit of the N-oligosaccharyl transferase (OST) complex. It is present in the rough endoplasmic reticulum. The gene encoding this protein is located on human chromosome 20q12-q13.

Immunogen

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 2 (RPN2) is suggested to be involved in ribosomal binding. It aids in the transfer of a mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue in many nascent polypeptide chains. RPN2 is also suggested to play a crucial role in the maintenance and translocation of the rough endoplasmic reticulum.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71042

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

HPA008297-25UL:
HPA008297-100UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Wei-Shan Chen et al.
Journal of clinical medicine, 10(18) (2021-09-29)
This study aims to evaluate the relationship between human ribophorin II (RPN2) and the effect of treatment using induction therapy with docetaxel, cisplatin, and fluorouracil (TPF) for p-16 negative locally advanced head and neck squamous cell carcinoma (HNSCC). A total
Daniel J Kelleher et al.
Molecular cell, 12(1), 101-111 (2003-07-31)
Oligosaccharyltransferase (OST) is an integral membrane protein that catalyzes N-linked glycosylation of nascent proteins in the lumen of the endoplasmic reticulum. Although the yeast OST is an octamer assembled from nonhomologous subunits (Ost1p, Ost2p, Ost3p/Ost6p, Ost4p, Ost5p, Wbp1p, Swp1p, and
C Löffler et al.
Human genetics, 87(2), 221-222 (1991-06-01)
Ribophorin I and II (RPN I and RPN II), two specific glycoproteins, span the rough regions of the endoplasmic reticulum (RER) and are thought to play an important role either in translocation or in the maintenance of RER. Studies with
C Crimaudo et al.
The EMBO journal, 6(1), 75-82 (1987-01-01)
Ribophorins I and II represent proteins that are postulated to be involved in ribosome binding. They are abundant, highly-conserved glycoproteins located exclusively in the membranes of the rough endoplasmic reticulum. As the first step in the further characterization of the
Kelley W Moremen et al.
Nature reviews. Molecular cell biology, 13(7), 448-462 (2012-06-23)
Protein glycosylation is a ubiquitous post-translational modification found in all domains of life. Despite their significant complexity in animal systems, glycan structures have crucial biological and physiological roles, from contributions in protein folding and quality control to involvement in a

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service