Skip to Content
Merck
All Photos(4)

Key Documents

Safety Information

HPA000536

Sigma-Aldrich

Anti-SOX11 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Sry (sex determining region y)-box 11

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
¥84,360

¥84,360


Available to ship onApril 23, 2025Details



Select a Size

Change View
100 μL
¥84,360

About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

¥84,360


Available to ship onApril 23, 2025Details


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SOX11(6664)

General description

SOX11 (SRY-box 11) is a transcription factor, that has a high mobility group (HMG) box. It is located on human chromosome 2p25. The protein is expressed in the central and peripheral nervous system, lungs, gastrointestinal tract, pancreas, spleen, kidneys, gonads and the mesenchyme.

Immunogen

Transcription factor SOX-11 recombinant protein epitope signature tag (PrEST)

Application

Anti-SOX11 antibody produced in rabbit has been used in immunohistochemistry and western blotting.

Biochem/physiol Actions

SOX11 (SRY-box 11) plays an important role in the development of the brain. Deletion and de novo mutations of SOX11 results in neurodevelopmental disorders along with characteristics of Coffin−Siris syndrome. The protein also has a role in embryonic and adult neurogenesis, craniofacial osteogenesis, ocular morphogenesis and cardiac growth.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76154

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

HPA000536-100UL:
HPA000536-25UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The three SoxC proteins?Sox4, Sox11 and Sox12?exhibit overlapping expression patterns and molecular properties.
Dy P, et al.
Nucleic Acids Research, 36(9), 3101-3117 (2008)
Yuka Kawaji-Kanayama et al.
Cancer science, 115(2), 452-464 (2023-12-05)
B-cell receptor (BCR) signaling is critically activated and stable for mantle cell lymphoma (MCL), but the underlying mechanism of the activated BCR signaling pathway is not clear. The pathogenic basis of miR-17-92 cluster remains unclear although the oncogenic microRNA (miRNA)
Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype.
Ribera-Cortada I, et al.
Modern Pathology, 28(11), 1435-1435 (2015)
Yasuyuki Otsuka et al.
Clinical case reports, 5(4), 477-481 (2017-04-12)
We report here a patient with extremely indolent mantle cell lymphoma (MCL) who had progressed and required immunochemotherapy 20 years after diagnostic splenectomy. Non-nodal, indolent MCL patients may progress after such an extraordinary long indolent phase, and we recommend lifelong follow
Impact of Sox11 over-expression in Ba/F3 cells.
Martin Lord et al.
Haematologica, 103(12), e594-e597 (2018-06-30)

Articles

Mesenchymal stem cell markers and antibodies suitable for investigating targets in fibroblasts, chondrocytes, adipocytes, osteoblasts, and muscle cells.

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service