Skip to Content
Merck
All Photos(1)

Key Documents

Safety Information

AV53653

Sigma-Aldrich

Anti-ST6GALNAC2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-SIAT7, Anti-SIAT7B, Anti-SIATL1, Anti-ST6 -N-acetylgalactosaminide α-2,6-sialyltransferase 2, Anti-ST6GalNAII, Anti-STHM

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

42 kDa

species reactivity

human, horse, rat, rabbit, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase is an enzyme encoded by the ST6GALNAC2 gene in humans. It belongs to the family of sialyltransferases. It is found in various human cell lines and is also expressed in most cell types with notable exceptions for several myeloid and lymphoid cell lines.

Immunogen

Synthetic peptide directed towards the middle region of human ST6GALNAC2

Application

Anti-ST6GALNAC2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

ST6GALNAC2 is primarily expressed in skeletal muscle, heart, kidney, placenta, lung and leukocytes. Overexpression of ST6GALNAC2 abolishes the cell surface HECA-452/CLA expression, reduces the number of rolling leukocytes on P- and L-selectin-bearing substrates as well as enhances the median rolling velocity of remaining cells during the synthesis of the leukocyte selectin ligand on human P-selectin glycoprotein ligand-1. Increased expression of the sialyltransferase ST6GalNAc-II indirectly reduces the galactosylation of the O-glycan substrate.

Sequence

Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV53653-100UL:
AV53653-50UG:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Georgia Sotiropoulou et al.
Molecular medicine (Cambridge, Mass.), 8(1), 42-55 (2002-05-02)
We sought to identify genes with altered expression during human breast cancer progression by applying mRNA comparisons of normal and tumor mammary cell lines with increasingly malignant phenotypes. The gene encoding a new sialyltransferase (STM) was found to be down-regulated
Hitoshi Suzuki et al.
The Journal of biological chemistry, 289(8), 5330-5339 (2014-01-09)
IgA nephropathy (IgAN), the most common primary glomerulonephritis, is characterized by renal immunodeposits containing IgA1 with galactose-deficient O-glycans (Gd-IgA1). These immunodeposits originate from circulating immune complexes consisting of anti-glycan antibodies bound to Gd-IgA1. As clinical disease onset and activity of
Milan Raska et al.
Journal of molecular biology, 369(1), 69-78 (2007-04-10)
Glycosylation defects occur in several human diseases. In IgA nephropathy, IgA1 contains O-glycans that are galactose-deficient and consist mostly of core 1 alpha2,6 sialylated N-acetylgalactosamine, a configuration suspected to prevent beta1,3 galactosylation. We confirmed the same aberrancy in IgA1 secreted
B Samyn-Petit et al.
Biochimica et biophysica acta, 1474(2), 201-211 (2000-04-01)
A cDNA clone encoding a human Galbeta1-3GalNAc alpha2, 6-sialyltransferase (designated hST6GalNAc II) was identified employing the PCR with degenerated primers to the sialylmotifs, followed by BLAST analysis of databanks. This sialyltransferase sequence is similar to that of previously cloned ST6GalNAc
Chi Y Lo et al.
The Journal of biological chemistry, 288(20), 13974-13987 (2013-04-04)
The binding of selectins to carbohydrate ligands expressed on leukocytes regulates immunity and inflammation. Among the human selectin ligands, the O-linked glycans at the N-terminus of the leukocyte cell-surface molecule P-selectin glycoprotein ligand-1 (PSGL-1, CD162) are important because they bind

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service