AV52043

Anti-CSNK1G3 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Casein kinase 1, γ 3
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 48 kDa
• species reactivity: rabbit, horse, bovine, mouse, rat, dog, guinea pig, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001038187
• UniProt accession no.: Q9Y6M4
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CSNK1G3(1456)

Description

Immunogen

Synthetic peptide directed towards the middle region of human CSNK1G3

Biochem/physiol Actions

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.

Sequence

Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable