Skip to Content
Merck
All Photos(1)

Key Documents

Safety Information

AV50505

Sigma-Aldrich

Anti-AIM2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Absent in melanoma 2, Anti-PYHIN4

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

human, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... AIM2(9447)

General description

The gene AIM2 (Absent in melanoma 2) is mapped to human chromosome 1q22. It belongs to the IFI20X /IFI16 family. AIM2 transcripts are detected in spleen, small intestine, testis and peripheral blood leukocytes.

Immunogen

Synthetic peptide directed towards the N terminal region of human AIM2

Application

Anti-AIM2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Absent in melanoma 2 (AIM2) is induced by IFN-γ. The probable roles of AIM2 are regulation of cell proliferation, inflammation and benign prostate hyperplasia. It also suppresses proliferation and tumorigenicity of human breast cancer cells. AIM2 is a suppressor of melanoma tumorigenicity. AIM2 is up-regulated in humans with hepatitis B virus-associated glomerulonephritis. AIM2 expression was positively correlated with caspase-1 and IL (Interleukin)-1β expression. AIM2 is also a component of inflammasome and can sense cytoplasmic DNA, causing activation of ASC (apoptosis-associated speck-like protein containing a CARD) pyroptosome and caspase-1.

Sequence

Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV50505-50UG:
AV50505-100UL:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Larissa Ponomareva et al.
Molecular cancer research : MCR, 11(10), 1193-1202 (2013-07-19)
Close links have been noted between chronic inflammation of the prostate and the development of human prostatic diseases such as benign prostate hyperplasia (BPH) and prostate cancer. However, the molecular mechanisms that contribute to prostatic inflammation remain largely unexplored. Recent
K L DeYoung et al.
Oncogene, 15(4), 453-457 (1997-07-24)
Chromosome 6-mediated suppression of tumorigenicity in malignant melanoma cell lines provides a model system to identify genes associated with the reversion of the tumorigenic phenotype. Using subtractive cDNA selection, we recently identified a series of novel genes which are differentially
Junhui Zhen et al.
Mediators of inflammation, 2014, 190860-190860 (2014-04-05)
AIM2 plays an important role in innate immunity, but its role in regulating the immune response to hepatitis B virus (HBV) is unknown. We hypothesized that AIM2 expression is positively correlated with HBV-mediated inflammation in patients with HBV-associated glomerulonephritis (HBV-GN)
I-Fen Chen et al.
Molecular cancer therapeutics, 5(1), 1-7 (2006-01-25)
IFN-inducible proteins are known to mediate IFN-directed antitumor effects. The human IFN-inducible protein absent in melanoma 2 (AIM2) gene encodes a 39-kDa protein, which contains a 200-amino-acid repeat as a signature of HIN-200 family (hematopoietic IFN-inducible nuclear proteins). Although AIM2
Teresa Fernandes-Alnemri et al.
Nature, 458(7237), 509-513 (2009-01-23)
Host- and pathogen-associated cytoplasmic double-stranded DNA triggers the activation of a NALP3 (also known as cryopyrin and NLRP3)-independent inflammasome, which activates caspase-1 leading to maturation of pro-interleukin-1beta and inflammation. The nature of the cytoplasmic-DNA-sensing inflammasome is currently unknown. Here we

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service