AV48481

Anti-OXCT1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-3-Oxoacid CoA transferase 1, Anti-OXCT, Anti-SCOT
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 52 kDa
• species reactivity: yeast, guinea pig, rat, bovine, human, mouse, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_000427
• UniProt accession no.: P55809
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... OXCT1(5019)

Description

General description

3-Oxoacid CoA transferase 1 (OCT1) is a mitochondrial enzyme that catalyzes the transfer of coenzyme A from succinyl-CoA to acetoacetate during ketone body catabolism. Mutations in OXCT1 have been linked to Succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.
Rabbit Anti-OXCT1 antibody recognizes pig, bovine, chicken, human, mouse, and rat, OXCT1.

Immunogen

Synthetic peptide directed towards the middle region of human OXCT1

Application

Rabbit Anti-OXCT1 (AB2) antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Biochem/physiol Actions

CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.

Sequence

Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable