Skip to Content
Merck
All Photos(1)

Documents

Safety Information

AV45602

Sigma-Aldrich

Anti-ESRRG antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DKFZp781L1617, Anti-ERR3, Anti-Estrogen-related receptor γ, Anti-FLJ16023, Anti-KIAA0832, Anti-NR3B3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

guinea pig, horse, rat, human, bovine, dog, rabbit, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ESRRG(2104)

Related Categories

Immunogen

Synthetic peptide directed towards the N terminal region of human ESRRG

Application

Anti-ESRRG antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Estrogen-related receptor gamma (ESRRG) is an orphan nuclear receptor that belongs to the estrogen receptor-related receptor family. ESRR family members have the same set of target genes and regulators as the estrogen receptors. ESRRG acts as a transcriptional activator of DNA cytosine-5-methyltransferases 1 and modulates cell proliferation, osteoblast differentiation and bone formation and energy metabolism in human trophoblasts. Studies indicate that this receptor mediates antidiabetic effect as it inhibits hepatic gluconeogenesis.

Sequence

Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV45602-100UL:
AV45602-50UG:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Don-Kyu Kim et al.
Diabetes, 62(9), 3093-3102 (2013-06-19)
Type 2 diabetes mellitus (T2DM) is a progressive metabolic disorder with diverse pathological manifestations and is often associated with abnormal regulation of hepatic glucose production. Many nuclear receptors known to control the hepatic gluconeogenic program are potential targets for the
Byung-Chul Jeong et al.
The Journal of biological chemistry, 284(21), 14211-14218 (2009-03-28)
Estrogen receptor-related receptor gamma (ERRgamma/ERR3/NR3B3) is a member of the orphan nuclear receptor with important functions in development and homeostasis. Recently it has been reported that ERRalpha is involved in osteoblast differentiation and bone formation. In the present study we
D Poidatz et al.
Placenta, 33(9), 688-695 (2012-07-06)
Placenta growth and functions depend on correct trophoblast migration, proliferation, and differentiation. The placenta has a critical role in gas and nutrient transport. To accomplish these numerous functions, the placenta depends on a highly efficient energy metabolism control. Recent studies

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service