Skip to Content
Merck
All Photos(1)

Key Documents

Safety Information

AV37882

Sigma-Aldrich

Anti-HOXA3 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
¥37,050

¥37,050


Check Cart for Availability


Select a Size

Change View
100 μL
¥37,050

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

¥37,050


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

49 kDa

species reactivity

mouse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

mouse ... HOXA3(15400)

General description

HOX proteins are transcription factors involve in spatial and temporal order critical to body patterning (axial patterning) and limb development during embryonic development. HOXA3 promotes the differentiation of hematopoietic progenitor cells and is a cell mobilization/migration factor that supports angiogenesis, wound repair and aortic arch patterning and remodeling.

Specificity

Anti-HOXA3 (AB2) polyclonal antibody reacts with mouse and rat Homeobox A3 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse HOXA3

Application

Anti-HOXA3 (AB2) polyclonal antibody is used to tag the Homeobox A3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of Homeobox A3 in angiogenesis and body pattern development during embryogenesis and wound repair.

Biochem/physiol Actions

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. The HOXA3 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation

Sequence

Synthetic peptide located within the following region: YDSSAIYGGYPYQAANGFAYNASQQPYAPSAALGTDGVEYHRPACSLQSP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV37882-100UL:
AV37882-100UG:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service