Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

AV31658

Sigma-Aldrich

Anti-ETV5 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-ERM, Anti-Ets variant gene 5 (Ets-related molecule)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
¥62,700

¥62,700


Check Cart for Availability
New, lower price on this item!


Select a Size

Change View
100 μL
¥62,700

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

¥62,700


Check Cart for Availability
New, lower price on this item!

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

58 kDa

species reactivity

horse, dog, guinea pig, human, rabbit, bovine, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ETV5(2119)

General description

ETV5 is a transcription factor that regulates the self-renewal of spermatogonial stem cells (SSCs). ETV5 loss has been linked to SSC loss and infertility.
Rabbit Anti-ETV5 (AB2) antibody recognizes human, mouse, bovine, zebrafish, canine, and rat ETV5.

Immunogen

Synthetic peptide directed towards the N terminal region of human ETV5

Application

Rabbit Anti-ETV5 (AB2) antibody can be used for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer.

Sequence

Synthetic peptide located within the following region: MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV31658-50UG:
AV31658-100UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Heather N Schlesser et al.
Biology of reproduction, 78(3), 483-489 (2007-11-23)
The transcription factor ets variant gene 5 (ETV5; also known as ERM) is essential for self-renewal of spermatogonial stem cells (SSCs). Mice with targeted disruption of Etv5 (Etv5(-/-)) undergo the first wave of spermatogenesis, but all SSCs are lost during

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service