Skip to Content
Merck
All Photos(1)

Key Documents

AV42553

Sigma-Aldrich

Anti-AKR1B10 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-AKR1B11, Anti-AKR1B12, Anti-ALDRLn, Anti-ARL-1, Anti-ARL1, Anti-Aldo-keto reductase family 1, member B10 (aldose reductase), Anti-HIS, Anti-HSI

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

35 kDa

species reactivity

rabbit, human, dog, yeast, horse, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... AKR1B10(57016)

General description

Aldo-keto reductase family 1B10 (AKR1B10) exhibits restricted lipid substrate specificity including farnesal, geranylgeranial, retinal and carbonyls; wherein metabolizing these lipid substrates has a crucial role in promoting carcinogenesis. AKR1B10 and 1B12 display high catalytic efficiency with all-trans-retinaldehyde. Aldo-keto reductase 1B10 (AKR1B10) is a secretory protein that is upregulated with tumorigenic transformation of human mammary epithelial cells. It is a tumor marker for cancers such as pancreatic cancer, lung carcinomas.

Specificity

Anti-AKR1B10 polyclonal antibody reacts with human, mouse, rat, and zebrafish aldo-keto reductase family 1, member B10 (aldose reductase) enzymes..

Immunogen

Synthetic peptide directed towards the N terminal region of human AKR1B10

Application

Anti-AKR1B10 polyclonal antibody is used to tag advanced AKR1B10 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a potential tumor marker for pancreatic and lung cancer.

Biochem/physiol Actions

AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Sequence

Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service