AMAB91130
Monoclonal Anti-CHAT antibody produced in mouse
Prestige Antibodies® Powered by Atlas Antibodies, clone CL3173, purified immunoglobulin, buffered aqueous glycerol solution
Synonym(s):
Anti-CHOACTASE, Anti-CMS1A, Anti-CMS1A2, Anti-CMS6
Sign Into View Organizational & Contract Pricing
All Photos(9)
About This Item
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
CL3173, monoclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, human, rat
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 2-10 μg/mg (Fixation/Permeabilization: PFA/Triton X-100)
immunohistochemistry: 1:1000- 1:2500
isotype
IgG2b
immunogen sequence
GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CHAT(1103)
General description
Choline O-acetyltransferase (CHAT) gene is mapped to human chromosome 10q11.23. It has a choline binding domain pocket and a catalytic domain.
Immunogen
choline O-acetyltransferase
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Choline O-acetyltransferase (CHAT) enzyme mediates the synthesis of neurotransmitter, acetylcholine from choline and acetyl-CoA in cholinergic neurons. Phosphorylation at serine and threonine residues is critical for the function of CHAT. Mutations in the active site residues, results in loss of enzyme activity. Deletion in CHAT gene locus impacts neuromuscular signal transmission contributing to muscle weakness in congenital myasthenic syndromes. A mutation in the CHAT gene leads to choline acetyltransferase deficiency and triggers recurrent breathlessness in infants. Polymorphisms in CHAT is implicated in Alzheimer′s disease.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST74314
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
recommended
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Association of Choline Acetyltransferase Gene Polymorphisms (SNPs rs868750G/A, rs1880676G/A, rs2177369G/A and rs3810950G/A) with Alzheimer?s Disease Risk: A Meta-Analysis
Yuan H, et al.
PLoS ONE, 11(7), e0159022-e0159022 (2016)
Congenital myasthenic syndrome associated with episodic apnea and sudden infant death
Byring RF, et al.
Neuromuscular Disorders, 12(6), 548-553 (2002)
Functional consequences and structural interpretation of mutations of human choline acetyltransferase
Shen Xm, et al.
Human Mutation, 32(11), 1259-1267 (2011)
Linyan Ma et al.
Investigative ophthalmology & visual science, 65(4), 30-30 (2024-04-18)
This study aims to elucidate the calcitonin gene-related peptide (CGRP) mediation and primary mechanism of corneal sensory nerves on tear production of the lacrimal gland. Mouse corneal denervation models were constructed through surgical axotomy, pharmacologic treatment with capsaicin or resiniferatoxin
How chromosomal deletions can unmask recessive mutations? Deletions in 10q11. 2 associated with CHAT or SLC18A3 mutations lead to congenital myasthenic syndrome
Schwartz M, et al.
American Journal of Medical Genetics. Part A, 176(1), 151-155 (2018)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service